Toll-like receptor 5 ligands and methods of use


Ontology type: sgo:Patent     


Patent Info

DATE

N/A

AUTHORS

Alan Aderem , Fumitaka Hayashi , Kelly D. Smith , David M. Underhill , Adrian Ozinsky

ABSTRACT

The invention provides an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQ (SEQ ID NO:44), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TQFSGVKVLAQDNTLTIQVGANDGETIDIDLKQINS QTLGLDTL (SEQ ID NO:45); EGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVNG (SEQ ID NO:46) or MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANF TANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQS (SEQ ID NO:47), or a modification thereof. Also provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TLRSDLGAVQNRFNSAITNLGNTVNNLSS (SEQ ID NO:49) or EQAAKTTENPLQKIDAALAQVDTLRSDLGAVQNRFNSAITNLGNTVNNLSS (SEQ ID NO:50), or a modification thereof. Further provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAE ITQ (SEQ ID NO:44) and substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding. Methods of using immunomodulatory flagellin peptides additionally are provided. More... »

JSON-LD is the canonical representation for SciGraph data.

TIP: You can open this SciGraph record using an external JSON-LD service: JSON-LD Playground Google SDTT

[
  {
    "@context": "https://springernature.github.io/scigraph/jsonld/sgcontext.json", 
    "about": [
      {
        "id": "http://purl.org/au-research/vocabulary/anzsrc-for/2008/3103", 
        "inDefinedTermSet": "http://purl.org/au-research/vocabulary/anzsrc-for/2008/", 
        "type": "DefinedTerm"
      }
    ], 
    "author": [
      {
        "name": "Alan Aderem", 
        "type": "Person"
      }, 
      {
        "name": "Fumitaka Hayashi", 
        "type": "Person"
      }, 
      {
        "name": "Kelly D. Smith", 
        "type": "Person"
      }, 
      {
        "name": "David M. Underhill", 
        "type": "Person"
      }, 
      {
        "name": "Adrian Ozinsky", 
        "type": "Person"
      }
    ], 
    "citation": [
      {
        "id": "https://doi.org/10.1016/0264-410x(92)90071-q", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1001196009"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "https://doi.org/10.1073/pnas.250476497", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1003818769"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "https://doi.org/10.1016/s0923-2508(00)00227-8", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1004034551"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "https://doi.org/10.1006/jsbi.2000.4312", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1006768304"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "https://doi.org/10.1016/s0952-7915(99)80003-x", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1009935949"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "sg:pub.10.1038/342648a0", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1015633149", 
          "https://doi.org/10.1038/342648a0"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "https://doi.org/10.1172/jci8892", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1016367219"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "https://doi.org/10.1016/0006-291x(92)91354-s", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1017338520"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "https://doi.org/10.1046/j.1365-313x.1999.00265.x", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1019514125"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "https://doi.org/10.1016/s1359-6101(00)00006-x", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1024213928"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "https://doi.org/10.1006/jmbi.1997.1111", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1035142831"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "sg:pub.10.1038/ni1011", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1038299302", 
          "https://doi.org/10.1038/ni1011"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "https://doi.org/10.1172/jci10501", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1043834172"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "https://doi.org/10.1016/s1097-2765(00)80136-7", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1044317166"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "sg:pub.10.1038/41131", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1048300852", 
          "https://doi.org/10.1038/41131"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "https://doi.org/10.1006/geno.2000.6115", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1050866707"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "https://doi.org/10.1128/iai.68.10.5525-5529.2000", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1052536090"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "https://doi.org/10.1073/pnas.86.13.4953", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1052837244"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "https://doi.org/10.1073/pnas.95.2.588", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1053189019"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "https://doi.org/10.1093/infdis/170.6.1508", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1059704871"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "https://doi.org/10.1126/science.2468182", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1062538915"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "https://doi.org/10.1126/science.285.5428.732", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1062566118"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "https://doi.org/10.1128/jb.171.6.3031-3038.1989", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1062717942"
        ], 
        "type": "CreativeWork"
      }, 
      {
        "id": "https://doi.org/10.1128/jb.177.6.1610-1613.1995", 
        "sameAs": [
          "https://app.dimensions.ai/details/publication/pub.1062724603"
        ], 
        "type": "CreativeWork"
      }
    ], 
    "description": "

The invention provides an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQ (SEQ ID NO:44), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TQFSGVKVLAQDNTLTIQVGANDGETIDIDLKQINS QTLGLDTL (SEQ ID NO:45); EGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVNG (SEQ ID NO:46) or MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANF TANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQS (SEQ ID NO:47), or a modification thereof. Also provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TLRSDLGAVQNRFNSAITNLGNTVNNLSS (SEQ ID NO:49) or EQAAKTTENPLQKIDAALAQVDTLRSDLGAVQNRFNSAITNLGNTVNNLSS (SEQ ID NO:50), or a modification thereof. Further provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAE ITQ (SEQ ID NO:44) and substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding. Methods of using immunomodulatory flagellin peptides additionally are provided.

", "id": "sg:patent.US-8703146-B2", "keywords": [ "Toll-like receptor", "method", "invention", "flagellin", "amino acid sequence", "ID", "modification", "receptor", "toll-like receptor 5", "binding" ], "name": "Toll-like receptor 5 ligands and methods of use", "recipient": [ { "id": "https://www.grid.ac/institutes/grid.64212.33", "type": "Organization" } ], "sameAs": [ "https://app.dimensions.ai/details/patent/US-8703146-B2" ], "sdDataset": "patents", "sdDatePublished": "2019-03-07T15:34", "sdLicense": "https://scigraph.springernature.com/explorer/license/", "sdPublisher": { "name": "Springer Nature - SN SciGraph project", "type": "Organization" }, "sdSource": "s3://com.uberresearch.data.dev.patents-pipeline/full_run_10/sn-export/5eb3e5a348d7f117b22cc85fb0b02730/0000100128-0000348334/json_export_962f20a5.jsonl", "type": "Patent" } ]
 

Download the RDF metadata as:  json-ld nt turtle xml License info

HOW TO GET THIS DATA PROGRAMMATICALLY:

JSON-LD is a popular format for linked data which is fully compatible with JSON.

curl -H 'Accept: application/ld+json' 'https://scigraph.springernature.com/patent.US-8703146-B2'

N-Triples is a line-based linked data format ideal for batch operations.

curl -H 'Accept: application/n-triples' 'https://scigraph.springernature.com/patent.US-8703146-B2'

Turtle is a human-readable linked data format.

curl -H 'Accept: text/turtle' 'https://scigraph.springernature.com/patent.US-8703146-B2'

RDF/XML is a standard XML format for linked data.

curl -H 'Accept: application/rdf+xml' 'https://scigraph.springernature.com/patent.US-8703146-B2'


 

This table displays all metadata directly associated to this object as RDF triples.

122 TRIPLES      14 PREDICATES      47 URIs      17 LITERALS      2 BLANK NODES

Subject Predicate Object
1 sg:patent.US-8703146-B2 schema:about anzsrc-for:3103
2 schema:author N5c447ba7a7844eb08c597114fafeb426
3 schema:citation sg:pub.10.1038/342648a0
4 sg:pub.10.1038/41131
5 sg:pub.10.1038/ni1011
6 https://doi.org/10.1006/geno.2000.6115
7 https://doi.org/10.1006/jmbi.1997.1111
8 https://doi.org/10.1006/jsbi.2000.4312
9 https://doi.org/10.1016/0006-291x(92)91354-s
10 https://doi.org/10.1016/0264-410x(92)90071-q
11 https://doi.org/10.1016/s0923-2508(00)00227-8
12 https://doi.org/10.1016/s0952-7915(99)80003-x
13 https://doi.org/10.1016/s1097-2765(00)80136-7
14 https://doi.org/10.1016/s1359-6101(00)00006-x
15 https://doi.org/10.1046/j.1365-313x.1999.00265.x
16 https://doi.org/10.1073/pnas.250476497
17 https://doi.org/10.1073/pnas.86.13.4953
18 https://doi.org/10.1073/pnas.95.2.588
19 https://doi.org/10.1093/infdis/170.6.1508
20 https://doi.org/10.1126/science.2468182
21 https://doi.org/10.1126/science.285.5428.732
22 https://doi.org/10.1128/iai.68.10.5525-5529.2000
23 https://doi.org/10.1128/jb.171.6.3031-3038.1989
24 https://doi.org/10.1128/jb.177.6.1610-1613.1995
25 https://doi.org/10.1172/jci10501
26 https://doi.org/10.1172/jci8892
27 schema:description <p num="p-0001">The invention provides an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQ (SEQ ID NO:44), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TQFSGVKVLAQDNTLTIQVGANDGETIDIDLKQINS QTLGLDTL (SEQ ID NO:45); EGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVNG (SEQ ID NO:46) or MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANF TANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQS (SEQ ID NO:47), or a modification thereof. Also provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TLRSDLGAVQNRFNSAITNLGNTVNNLSS (SEQ ID NO:49) or EQAAKTTENPLQKIDAALAQVDTLRSDLGAVQNRFNSAITNLGNTVNNLSS (SEQ ID NO:50), or a modification thereof. Further provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAE ITQ (SEQ ID NO:44) and substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding. Methods of using immunomodulatory flagellin peptides additionally are provided.</p>
28 schema:keywords ID
29 Toll-like receptor
30 amino acid sequence
31 binding
32 flagellin
33 invention
34 method
35 modification
36 receptor
37 toll-like receptor 5
38 schema:name Toll-like receptor 5 ligands and methods of use
39 schema:recipient https://www.grid.ac/institutes/grid.64212.33
40 schema:sameAs https://app.dimensions.ai/details/patent/US-8703146-B2
41 schema:sdDatePublished 2019-03-07T15:34
42 schema:sdLicense https://scigraph.springernature.com/explorer/license/
43 schema:sdPublisher N64b659bd3c274982a858bf9778d5b99f
44 sgo:license sg:explorer/license/
45 sgo:sdDataset patents
46 rdf:type sgo:Patent
47 N07192396cb694e66a88340e29231914d rdf:first N84c05cb52feb4c1abc0de543056d74f5
48 rdf:rest N9f874f5909d840d395d363fa8790a26d
49 N342c98540eea49cbbfcb6e1d6f957a24 rdf:first Nc380cc6653254c2b8ba470c602d409a2
50 rdf:rest rdf:nil
51 N3439b1ff7b0f41e5bda5b428af876ce6 schema:name Alan Aderem
52 rdf:type schema:Person
53 N5c447ba7a7844eb08c597114fafeb426 rdf:first N3439b1ff7b0f41e5bda5b428af876ce6
54 rdf:rest Nc9a5544ad03a425898b0d3192792b4a5
55 N5fe27e46122a4fed810ff5f45168e5ef schema:name David M. Underhill
56 rdf:type schema:Person
57 N64b659bd3c274982a858bf9778d5b99f schema:name Springer Nature - SN SciGraph project
58 rdf:type schema:Organization
59 N84c05cb52feb4c1abc0de543056d74f5 schema:name Kelly D. Smith
60 rdf:type schema:Person
61 N9f874f5909d840d395d363fa8790a26d rdf:first N5fe27e46122a4fed810ff5f45168e5ef
62 rdf:rest N342c98540eea49cbbfcb6e1d6f957a24
63 Nc380cc6653254c2b8ba470c602d409a2 schema:name Adrian Ozinsky
64 rdf:type schema:Person
65 Nc9a5544ad03a425898b0d3192792b4a5 rdf:first Nd3f9f66c41c845d99d33f3573542722e
66 rdf:rest N07192396cb694e66a88340e29231914d
67 Nd3f9f66c41c845d99d33f3573542722e schema:name Fumitaka Hayashi
68 rdf:type schema:Person
69 anzsrc-for:3103 schema:inDefinedTermSet anzsrc-for:
70 rdf:type schema:DefinedTerm
71 sg:pub.10.1038/342648a0 schema:sameAs https://app.dimensions.ai/details/publication/pub.1015633149
72 https://doi.org/10.1038/342648a0
73 rdf:type schema:CreativeWork
74 sg:pub.10.1038/41131 schema:sameAs https://app.dimensions.ai/details/publication/pub.1048300852
75 https://doi.org/10.1038/41131
76 rdf:type schema:CreativeWork
77 sg:pub.10.1038/ni1011 schema:sameAs https://app.dimensions.ai/details/publication/pub.1038299302
78 https://doi.org/10.1038/ni1011
79 rdf:type schema:CreativeWork
80 https://doi.org/10.1006/geno.2000.6115 schema:sameAs https://app.dimensions.ai/details/publication/pub.1050866707
81 rdf:type schema:CreativeWork
82 https://doi.org/10.1006/jmbi.1997.1111 schema:sameAs https://app.dimensions.ai/details/publication/pub.1035142831
83 rdf:type schema:CreativeWork
84 https://doi.org/10.1006/jsbi.2000.4312 schema:sameAs https://app.dimensions.ai/details/publication/pub.1006768304
85 rdf:type schema:CreativeWork
86 https://doi.org/10.1016/0006-291x(92)91354-s schema:sameAs https://app.dimensions.ai/details/publication/pub.1017338520
87 rdf:type schema:CreativeWork
88 https://doi.org/10.1016/0264-410x(92)90071-q schema:sameAs https://app.dimensions.ai/details/publication/pub.1001196009
89 rdf:type schema:CreativeWork
90 https://doi.org/10.1016/s0923-2508(00)00227-8 schema:sameAs https://app.dimensions.ai/details/publication/pub.1004034551
91 rdf:type schema:CreativeWork
92 https://doi.org/10.1016/s0952-7915(99)80003-x schema:sameAs https://app.dimensions.ai/details/publication/pub.1009935949
93 rdf:type schema:CreativeWork
94 https://doi.org/10.1016/s1097-2765(00)80136-7 schema:sameAs https://app.dimensions.ai/details/publication/pub.1044317166
95 rdf:type schema:CreativeWork
96 https://doi.org/10.1016/s1359-6101(00)00006-x schema:sameAs https://app.dimensions.ai/details/publication/pub.1024213928
97 rdf:type schema:CreativeWork
98 https://doi.org/10.1046/j.1365-313x.1999.00265.x schema:sameAs https://app.dimensions.ai/details/publication/pub.1019514125
99 rdf:type schema:CreativeWork
100 https://doi.org/10.1073/pnas.250476497 schema:sameAs https://app.dimensions.ai/details/publication/pub.1003818769
101 rdf:type schema:CreativeWork
102 https://doi.org/10.1073/pnas.86.13.4953 schema:sameAs https://app.dimensions.ai/details/publication/pub.1052837244
103 rdf:type schema:CreativeWork
104 https://doi.org/10.1073/pnas.95.2.588 schema:sameAs https://app.dimensions.ai/details/publication/pub.1053189019
105 rdf:type schema:CreativeWork
106 https://doi.org/10.1093/infdis/170.6.1508 schema:sameAs https://app.dimensions.ai/details/publication/pub.1059704871
107 rdf:type schema:CreativeWork
108 https://doi.org/10.1126/science.2468182 schema:sameAs https://app.dimensions.ai/details/publication/pub.1062538915
109 rdf:type schema:CreativeWork
110 https://doi.org/10.1126/science.285.5428.732 schema:sameAs https://app.dimensions.ai/details/publication/pub.1062566118
111 rdf:type schema:CreativeWork
112 https://doi.org/10.1128/iai.68.10.5525-5529.2000 schema:sameAs https://app.dimensions.ai/details/publication/pub.1052536090
113 rdf:type schema:CreativeWork
114 https://doi.org/10.1128/jb.171.6.3031-3038.1989 schema:sameAs https://app.dimensions.ai/details/publication/pub.1062717942
115 rdf:type schema:CreativeWork
116 https://doi.org/10.1128/jb.177.6.1610-1613.1995 schema:sameAs https://app.dimensions.ai/details/publication/pub.1062724603
117 rdf:type schema:CreativeWork
118 https://doi.org/10.1172/jci10501 schema:sameAs https://app.dimensions.ai/details/publication/pub.1043834172
119 rdf:type schema:CreativeWork
120 https://doi.org/10.1172/jci8892 schema:sameAs https://app.dimensions.ai/details/publication/pub.1016367219
121 rdf:type schema:CreativeWork
122 https://www.grid.ac/institutes/grid.64212.33 schema:Organization
 




Preview window. Press ESC to close (or click here)


...